PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 318aa    MW: 36278.6 Da    PI: 7.2691
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002238.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.1e-091452148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+lv++++ +G g W          R++k+c++rw++yl
      Pbr002238.1 14 RGLWSPEEDEKLVRYITTYGHG-WL--------QRCGKSCRLRWLNYL 52
                     788*******************.94........49***********97 PP

2Myb_DNA-binding49.78.2e-1658102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE++l+++++   G++ W+ Ia++++ gRt++++k++w+++
      Pbr002238.1  58 RGGFTPEEEKLIIRLHGVVGNR-WTHIAKCLP-GRTDNEIKNYWNSW 102
                      788*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.331952IPR017930Myb domain
SuperFamilySSF466895.62E-251299IPR009057Homeodomain-like
SMARTSM007178.4E-61354IPR001005SANT/Myb domain
PfamPF002494.0E-81452IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-171559IPR009057Homeodomain-like
PROSITE profilePS5129423.53653107IPR017930Myb domain
SMARTSM007175.4E-1657105IPR001005SANT/Myb domain
PfamPF002491.6E-1458102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2460107IPR009057Homeodomain-like
CDDcd001672.68E-1261103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGHHYCCKQR KVKRGLWSPE EDEKLVRYIT TYGHGWLQRC GKSCRLRWLN YLRPDIKRGG  60
FTPEEEKLII RLHGVVGNRW THIAKCLPGR TDNEIKNYWN SWIKKKLEKP SPPTTSPSNL  120
DHQHNYQMGC SCPNQQVFMN QNFITKPTAA RDQILYPSPY PLFMFDAVSL DETTNNNTNV  180
QSADQHFPLA RSNNSNNNGT WILDQQQQHQ VQAFPSSTAP FTNNNMDAQI LPSLLGSSIG  240
NNNMVPIEVE SCSNIDEEEE ISMECLQSTT QELNALVHSR QAQQCSSNNF HFWDNVEGPT  300
SSNLRSANIL SSFPSYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26141087109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363433.10.0PREDICTED: transcription factor MYB113-like
TrEMBLM5WCE01e-173M5WCE0_PRUPE; Uncharacterized protein
STRINGVIT_02s0025g00320.t011e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.15e-68myb domain protein 103